In Silico Analysis Prediction of B-Cell Epitope as a Vaccine Candidate for SARS-CoV-2 B.1.617.2 (Delta) Variant
Background: The COVID-19 pandemic by SARS-CoV-2 has caused many losses. One way to prevent the spread of this virus is to get vaccinated. However, the latest SARS-CoV-2 variants, including variant B.1.617.2 (Delta) are doubtful to be inhibited by existing vaccines because of mutations. Therefore, we...
Saved in:
| Main Authors: | , |
|---|---|
| Format: | EJournal Article |
| Published: |
Faculty of Medicine, Universitas Diponegoro,
2022-04-28.
|
| Subjects: | |
| Online Access: | Get Fulltext |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| LEADER | 03336 am a22002653u 4500 | ||
|---|---|---|---|
| 001 | BTR_UNDIP_13113_7148 | ||
| 042 | |a dc | ||
| 100 | 1 | 0 | |a Wattimena, Mauritz Nicolaas |e author |
| 700 | 1 | 0 | |a Wijanarka, Wijanarka |e author |
| 245 | 0 | 0 | |a In Silico Analysis Prediction of B-Cell Epitope as a Vaccine Candidate for SARS-CoV-2 B.1.617.2 (Delta) Variant |
| 260 | |b Faculty of Medicine, Universitas Diponegoro, |c 2022-04-28. | ||
| 500 | |a https://ejournal2.undip.ac.id/index.php/jbtr/article/view/13113 | ||
| 520 | |a Background: The COVID-19 pandemic by SARS-CoV-2 has caused many losses. One way to prevent the spread of this virus is to get vaccinated. However, the latest SARS-CoV-2 variants, including variant B.1.617.2 (Delta) are doubtful to be inhibited by existing vaccines because of mutations. Therefore, we need a new vaccine candidate that is effective against this SARS-CoV-2 variant. Through an immunoinformatics approach with various software and analysis websites, vaccine candidates can be predicted in a short time.Objective: Identity, analyze, obtain, and confirm the selected B-cell epitope sequence that can be used as a vaccine candidate for the SARS-CoV-2 B.1.617.2 (Delta) variant.Methods: This research was conducted by isolating the amino acid peptide sequence in the SARS-CoV-2 B.1.617.2 (Delta) variant protein spike from the Protein Data Bank which is suspected to be an immunogenic epitope and can be used as a vaccine candidate. A Series of tests were carried out such as antigenicity, toxicity, allergenicity, and BLAST® protein to ensure that this vaccine candidate is safe for later application into the human body. The next stage is a conservation analysis to see its potential by comparing it with the SARS-CoV-2 Delta (B.1.617.2) variant spike protein sequence in Indonesia. The study ended by mapping amino acid peptides to the SARS-CoV-2 Delta (B.1.617.2) variant spike protein using the Biovia Discovery Studio Visualizer v21.1.0.20298 2020 software to ensure that the selected sequences were epitope.Results: From the five amino acid peptides that have been isolated, the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence has good results than the others. It is probable an antigen, non-toxic, non-allergen, and non-homolog to the human body protein.Conclusion: Based on this in silico study, it was found that the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence was the best to be used as a vaccine candidate of SARS-CoV-2 B.1.617.2 (Delta) variant.Keywords: SARS-CoV-2 B.1.617.2 (Delta) variant, B-cell epitope, vaccine, in silico, immunoinformatics. | ||
| 540 | |a Copyright (c) 2022 Journal of Biomedicine and Translational Research | ||
| 540 | |a https://creativecommons.org/licenses/by-sa/4.0 | ||
| 546 | |a eng | ||
| 690 | |a SARS-CoV-2 B.1.617.2 (Delta) variant; B-cell epitope; vaccine; in silico; immunoinformatics. | ||
| 655 | 7 | |a info:eu-repo/semantics/article |2 local | |
| 655 | 7 | |a info:eu-repo/semantics/publishedVersion |2 local | |
| 655 | 7 | |2 local | |
| 786 | 0 | |n Journal of Biomedicine and Translational Research; Vol 8, No 1 (2022): April 2022; 7-15 | |
| 786 | 0 | |n 2503-2178 | |
| 786 | 0 | |n 10.14710/jbtr.v1i1 | |
| 787 | 0 | |n https://ejournal2.undip.ac.id/index.php/jbtr/article/view/13113/7148 | |
| 856 | 4 | 1 | |u https://ejournal2.undip.ac.id/index.php/jbtr/article/view/13113/7148 |z Get Fulltext |